CookSnap is coming soon — Join the waitlist →

Beef Suya Skewers

Smoky, spiced Nigerian beef skewers with a fiery peanut crust. Marinated in aromatics and grilled until charred, served with tangy tomato-onion relish.

Total time
45 min
Servings
4
Calories
420
Protein
42g
Beef Suya Skewers
boldcasualnigerianbeefcharredtendercrispyweeknight

Ingredients

  • 1.5 lbs beef sirloin or tenderloin, cut into 1-inch cubes
  • ½ cup roasted unsalted peanuts, finely ground
  • 1 tbsp cayenne pepper
  • 1 tbsp paprika
  • 3 cloves garlic, minced
  • 1 tbsp ginger, grated
  • 3 tbsp olive oil
  • 2 medium tomatoes, diced
  • ½ medium red onion, thinly sliced

Instructions

  1. 1

    Soak 8 wooden skewers in cold water for 20 minutes.

  2. 2

    Mix ground peanuts, cayenne, paprika, garlic, ginger, 0.5 tsp salt, and black pepper in a shallow bowl.

  3. 3

    Pat beef dry. Toss with 1 tbsp oil and a pinch of salt until coated evenly.

  4. 4

    Roll beef cubes in peanut mixture, pressing gently so coating adheres. Thread onto skewers, 4–5 pieces per skewer.

  5. 5

    Brush skewers with remaining 2 tbsp oil. Let rest 5 minutes.

  6. 6

    Toss diced tomato and onion with a pinch of salt and black pepper. Set aside.

  7. 7

    Heat grill or grill pan to medium-high (oil the grates lightly). Grill skewers 3–4 minutes, turning once, until edges char and beef cooks through.

  8. 8

    Transfer to a serving platter. Let rest 2 minutes.

  9. 9

    Spoon tomato relish over skewers. Serve immediately with lime wedges if desired.

Tools you’ll need

  • wooden skewers
  • shallow mixing bowl
  • grill or grill pan
  • long metal tongs
  • small cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.