CookSnap is coming soon — Join the waitlist →
Back to recipes

25-Min Beef Satay with Peanut Sauce

Tender marinated beef grilled until charred, served with a silky peanut sauce and crisp vegetable sides. One skillet, under 15 minutes active time.

Total time
25 min
Servings
2
Calories
485
Protein
38g
25-Min Beef Satay with Peanut Sauce
satisfyingfreshmalaysianbeeftendercharredcreamyweeknight

Ingredients

  • ¾ lb beef sirloin or ribeye, cut into 1-inch cubes
  • 3 tbsp soy sauce
  • 1 tbsp brown sugar
  • 3 cloves garlic, minced
  • ⅓ cup creamy peanut butter
  • 1 whole lime (juiced)
  • 1 whole cucumber, sliced thin
  • 1 whole tomato, sliced

Instructions

  1. 1

    Thread beef cubes onto metal or wooden skewers (soak wood 10 min first). Pat dry with paper towels.

  2. 2

    Whisk soy sauce, brown sugar, and minced garlic in a small bowl. Brush all over the skewered beef.

  3. 3

    Heat a cast iron skillet or grill pan over medium-high until smoking. Sear skewers 90 seconds per side until edges char.

  4. 4

    Whisk peanut butter with 3 tbsp warm water and half the lime juice until pourable. Season with salt and a pinch of cayenne.

  5. 5

    Arrange skewers on a plate with cucumber and tomato slices. Drizzle peanut sauce over the beef. Squeeze remaining lime on top.

Tools you’ll need

  • metal or wooden skewers (4–6 pieces)
  • 12-inch cast iron skillet or grill pan
  • small mixing bowl
  • whisk
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Malaysian recipes →