CookSnap is coming soon — Join the waitlist →

Bay Area Garlic Noodles with Shrimp

Buttery garlic noodles tossed with tender shrimp, a Bay Area classic. Ready in 20 minutes with minimal cleanup and maximum flavor.

Total time
20 min
Servings
2
Calories
620
Protein
38g
Bay Area Garlic Noodles with Shrimp
quicksatisfyingcalifornianshrimptendersilkyweeknightpasta

Ingredients

  • 8 oz spaghetti or linguine
  • ¾ lb large shrimp, peeled and deveined
  • 4 tbsp butter
  • 6 cloves garlic, minced
  • 2 tbsp soy sauce
  • 1 tbsp sesame oil
  • 3 scallions scallions, sliced thin crosswise
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Bring a large pot filled three-quarters full with salted water to a rolling boil over high heat, about 8 minutes. You'll see large bubbles rapidly breaking the surface.

  2. 2

    While the water boils, peel and devein the shrimp if not already done: pinch off the head, peel the shell away, and use a small knife to scrape out the thin dark line running down the back. Pat dry with a paper towel.

  3. 3

    Mince the garlic cloves by slicing them lengthwise, then crosswise, then chopping until the pieces are pencil-tip sized (smaller than a grain of rice).

  4. 4

    Slice the scallions crosswise into thin rings, keeping the white and light green parts separate from the dark green tops for now.

  5. 5

    Add the pasta to the boiling water and stir once with a fork to prevent clumping. Cook, stirring occasionally, until the pasta is tender but still has a slight firmness when you bite it, about 9 minutes or per package directions.

  6. 6

    While the pasta cooks, place a large skillet over medium-high heat and add 4 tablespoons of butter. Swirl the skillet until the butter melts and foams, about 45 seconds.

  7. 7

    Add the minced garlic to the melted butter and stir constantly for 30 seconds until the smell becomes intensely fragrant and the garlic looks golden-brown at the edges.

  8. 8

    Slide the shrimp into the garlic butter in a single layer. Let them sit without stirring for 90 seconds until the bottom of each shrimp turns opaque pink.

  9. 9

    Flip each shrimp with tongs and cook for another 90 seconds on the second side until fully opaque pink throughout, with no gray or translucent spots remaining.

  10. 10

    Pour 2 tablespoons of soy sauce and 1 tablespoon of sesame oil into the skillet. Stir gently to coat the shrimp, cooking for 10 seconds until the liquid is incorporated.

  11. 11

    Drain the cooked pasta in a colander, reserving 1 cup of the starchy cooking water in a separate bowl.

  12. 12

    Slide the drained pasta directly into the skillet with the shrimp and garlic butter. Toss with tongs for 60 seconds, lifting and folding the noodles to coat all strands evenly.

  13. 13

    If the noodles look dry, pour in 2 tablespoons of reserved pasta water and toss again until silky. Taste a bite and add salt and pepper if needed.

  14. 14

    Divide the garlic noodles and shrimp between two bowls, pouring any pan juices from the bottom of the skillet over the top.

  15. 15

    Scatter the sliced scallion greens (dark tops) over each bowl in a small handful. Serve immediately while steaming hot.

Tools you’ll need

  • large pot (6+ quarts)
  • large skillet (12-inch)
  • colander
  • wooden spoon or fork
  • tongs
  • small paring knife
  • paper towels
  • small bowl (for reserved pasta water)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.