CookSnap is coming soon — Join the waitlist →
Back to recipes

Garlic Butter Shrimp Pasta

Tender shrimp and spaghetti tossed in a silky garlic-butter sauce with a hint of lemon. Restaurant-quality in under 20 minutes.

Total time
18 min
Servings
2
Calories
520
Protein
38g
Garlic Butter Shrimp Pasta
elegantquickitalianshrimptendersilkyweeknightdate-night

Ingredients

  • 8 oz spaghetti
  • ¾ lb large shrimp, peeled and deveined
  • 4 tbsp butter
  • 5 clove garlic cloves, minced
  • 1 whole lemon
  • 1 to taste salt and black pepper to taste

Instructions

  1. 1

    Boil spaghetti in salted water until al dente, ~9 minutes. Reserve 1/2 cup pasta water, then drain.

  2. 2

    Pat shrimp dry with paper towels. Season generously with salt and black pepper.

  3. 3

    Melt 2 tbsp butter in a 12-inch skillet over medium-high heat until foaming, ~60 seconds.

  4. 4

    Add shrimp and sear without stirring for 2 minutes until the underside turns pink.

  5. 5

    Flip shrimp and cook 1 minute more until opaque throughout. Transfer to a plate.

  6. 6

    Reduce heat to medium. Add remaining 2 tbsp butter and minced garlic to the skillet.

  7. 7

    Cook, stirring constantly, until fragrant and golden, ~90 seconds. Watch for browning.

  8. 8

    Add cooked spaghetti, shrimp, and 1/4 cup pasta water. Toss until coated and creamy.

  9. 9

    Squeeze half the lemon over the pasta. Taste and adjust salt and pepper as needed.

  10. 10

    Divide between two bowls. Serve immediately with remaining lemon wedges.

Tools you’ll need

  • 12-inch skillet
  • large pot
  • colander
  • paper towels
  • tongs or slotted spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.