Custrd is out on the App Store — Download it free →
Back to recipes

Baked Minced Meat and Egg Dish with Fruit and Spices

A quick South African-inspired bobotie: savory minced meat baked with a golden egg topping, sweet fruit, and warm spices. Ready in about 30 minutes.

Total time
30 min
Servings
4
Calories
350
Protein
25g
Baked Minced Meat and Egg Dish with Fruit and Spices
comfortingsouth africangluten-freebeeftendercreamyweeknightcasserole

Ingredients

  • 1 lb minced beef
  • 1 medium onion
  • 2 cloves garlic
  • 1 tbsp curry powder
  • ½ cup dried apricots
  • 2 large eggs

Instructions

  1. 1

    Preheat oven to 375°F. In a skillet over medium heat, cook 1 diced onion and 2 minced garlic cloves until soft, about 5 minutes.

  2. 2

    Add 1 lb minced beef and 1 tbsp curry powder. Cook, breaking up meat, until browned, about 8 minutes. Stir in 0.5 cup chopped dried apricots.

  3. 3

    Transfer mixture to a baking dish. In a bowl, beat 2 eggs with a pinch of salt and pepper. Pour over meat.

  4. 4

    Bake until egg is set and top is golden, about 15 minutes. Let stand 2 minutes before serving.

  5. 5

    Serve warm with rice or bread if desired.

Tools you’ll need

  • skillet
  • baking dish
  • mixing bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.