Baked Gnocchi Marinara
Pillowy gnocchi tossed with marinara and melted mozzarella, baked until the cheese bubbles and the edges crisp up. This is comfort food in under 20 minutes.
- Total time
- 18 min
- Servings
- 3
- Calories
- 420
- Protein
- 15g
comfortitalianvegetariancreamycrispyweeknightpastabake
Ingredients
- 1 lb gnocchi (fresh or frozen)
- 1.5 cups marinara sauce
- 1.5 cups mozzarella cheese, shredded
Instructions
- 1
Boil gnocchi in salted water until they float, then boil 1 minute more; drain well.
- 2
Toss warm gnocchi with marinara sauce in a bowl, then spread into a baking dish.
- 3
Scatter mozzarella evenly over the gnocchi and sauce.
- 4
Bake at 425°F until cheese bubbles and edges brown, 8–10 minutes.
Tools you’ll need
- pot
- colander
- 8x8-inch or 9-inch baking dish
- oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
