CookSnap is coming soon — Join the waitlist →
Back to recipes

Bacalao con Tomate — Spanish Cod with Tomato Rice

Pan-seared cod over tomato rice with roasted cherry tomatoes in one sheet pan, ready in under 20 minutes. Bright, garlicky, and authentically Spanish.

Total time
18 min
Servings
2
Calories
385
Protein
32g
Bacalao con Tomate — Spanish Cod with Tomato Rice
freshcasualspanishfishflakytenderweeknightdinner

Ingredients

  • 2 fillets (6 oz each) cod fillets, skin-on or skinless
  • 1.5 cups cherry tomatoes, halved
  • ¾ cup canned diced tomatoes
  • 3 cloves garlic, minced
  • ¾ cup white rice, uncooked
  • 3 tbsp olive oil

Instructions

  1. 1

    Heat 2 tbsp olive oil in a large skillet over medium-high. Add garlic, cook 30 seconds until fragrant.

  2. 2

    Add rice, stir to coat, then pour in canned tomatoes with their juice and 1.25 cups water.

  3. 3

    Bring to a boil, then reduce heat to low, cover, and simmer for 12 minutes until rice is almost tender.

  4. 4

    Arrange halved cherry tomatoes on top of rice. Pat cod dry, season with salt and pepper, then lay on top.

  5. 5

    Drizzle cod with remaining 1 tbsp olive oil. Cover and cook 6–7 minutes until fish flakes easily at thickest point.

  6. 6

    Serve immediately in shallow bowls, spooning tomato rice and roasted cherry tomatoes alongside the cod.

Tools you’ll need

  • 12-inch skillet with lid
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Spanish recipes →