CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Sheet-Pan Snoek Braai with Roasted Potatoes

South African grilled snoek (or sea bass) with crispy roasted potatoes, lemon, and chili — all on one sheet pan. High-heat, minimal fuss, maximum flavor.

Total time
25 min
Servings
2
Calories
385
Protein
32g
Sheet-Pan Snoek Braai with Roasted Potatoes
casualfreshsouth-africanfishcrispytenderflakyweeknight

Ingredients

  • 2 fillets (about 6 oz each) snoek or sea bass fillets, skin-on
  • 1 lb small potatoes, halved
  • 1 whole lemon
  • 1 whole red chili, sliced
  • 3 tbsp olive oil
  • 1 to taste sea salt and black pepper

Instructions

  1. 1

    Heat oven to 450°F. Toss potatoes with 2 tbsp olive oil, salt, and pepper on a sheet pan.

  2. 2

    Roast potatoes for 12 minutes until they start to soften and edges brown.

  3. 3

    Pat fish dry. Brush both sides with remaining olive oil, season with salt and pepper.

  4. 4

    Push potatoes to the sides of the pan. Lay fish skin-side up in the center.

  5. 5

    Top fish with lemon slices and chili. Roast 8–10 minutes until skin is crispy and flesh flakes.

  6. 6

    Squeeze fresh lemon over the plate. Serve hot with potatoes and any pan juices.

Tools you’ll need

  • sheet pan
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.