CookSnap is coming soon — Join the waitlist →
Back to recipes

Chili Crisp Marlin Tacos

Pan-seared marlin with crispy skin, lime, and chili crisp folded into warm tortillas. Fresh, spicy, and ready in 15 minutes.

Total time
15 min
Servings
2
Calories
285
Protein
32g
Chili Crisp Marlin Tacos
freshcasualmexicanfishcrispytenderflakyweeknight

Ingredients

  • ¾ lb marlin fillet, skin on
  • 4 count corn tortillas
  • 2 tbsp chili crisp
  • 1 count lime
  • ¼ count white onion, thinly sliced
  • ¼ cup fresh cilantro, chopped

Instructions

  1. 1

    Pat marlin dry. Season generously with salt and black pepper on both sides.

  2. 2

    Heat oil in a skillet over medium-high until it shimmers, about 90 seconds.

  3. 3

    Place marlin skin-side down. Sear without moving for 2 minutes until skin is crispy and golden.

  4. 4

    Flip once and sear the other side 90 seconds until the center is just opaque.

  5. 5

    Transfer marlin to a cutting board. Warm tortillas in the same skillet 30 seconds per side.

  6. 6

    Break marlin into bite-sized flakes. Divide into tortillas, top with onion, cilantro, chili crisp, and a squeeze of lime.

Tools you’ll need

  • 12-inch stainless steel or cast iron skillet
  • cutting board
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.