CookSnap is coming soon — Join the waitlist →

Apple Galette

A rustic French tart with buttery pastry and caramelized apples, ready in under 30 minutes. Minimal ingredients, maximum elegance.

Total time
28 min
Servings
2
Calories
385
Protein
4g
Apple Galette
elegantsimplefrenchvegetariancrispyflakytenderweekend

Ingredients

  • 1 cup all-purpose flour
  • ¼ cup cold butter, cubed
  • ¼ teaspoon salt
  • 3 tablespoons ice water
  • 3 medium apples (firm, like Granny Smith), peeled and cored
  • 3 tablespoons sugar

Instructions

  1. 1

    Set the oven to 425°F and wait until the indicator light or beep tells you it has finished heating, about 10 minutes.

  2. 2

    Place the flour and salt in a medium bowl and stir once with a fork to mix.

  3. 3

    Add the cold butter cubes to the flour and use your fingertips to rub the butter and flour together until the mixture looks like coarse breadcrumbs with some pea-sized pieces of butter still visible.

  4. 4

    Pour in 3 tablespoons of ice water and stir with a fork until the dough just comes together into a shaggy ball; do not overmix.

  5. 5

    Press the dough into a flat disk, wrap it in plastic wrap, and place it in the freezer for 5 minutes so it becomes firm and easier to roll.

  6. 6

    Place each peeled apple on the cutting board and slice it lengthwise into 1/8-inch-thick slices, working around the core.

  7. 7

    Remove the dough from the freezer and place it between two pieces of parchment paper; use a rolling pin to roll it into a 10-inch circle, about 1/8-inch thick.

  8. 8

    Slide the dough circle (still on parchment) onto a 12-inch round baking sheet or pizza pan.

  9. 9

    Arrange the apple slices in a circular pattern on top of the dough, starting at the center and overlapping them slightly, leaving a 1-inch border around the edge.

  10. 10

    Sprinkle the 3 tablespoons of sugar evenly over the apples.

  11. 11

    Fold the 1-inch dough border up and over the edge of the apple filling, creasing it gently so it stays in place; it does not need to cover the apples completely.

  12. 12

    Place the baking sheet in the preheated oven and bake until the pastry turns the color of warm honey and the apples are soft when pierced with a fork, about 15 minutes.

  13. 13

    Remove the galette from the oven and let it rest on the baking sheet for 2 minutes before slicing.

Tools you’ll need

  • medium mixing bowl
  • fork
  • fingertips
  • plastic wrap
  • cutting board
  • chef's knife
  • rolling pin
  • parchment paper
  • 12-inch round baking sheet or pizza pan
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.