CookSnap is coming soon — Join the waitlist →
Back to recipes

Tarte Tatin

Caramelized apples baked under a golden pastry crust, then flipped to reveal a glossy, sticky top. A French classic that looks fancy but takes just 45 minutes.

Total time
45 min
Servings
6
Calories
295
Protein
2g
Tarte Tatin
elegantindulgentfrenchvegetariancrispytenderflakydate-night

Ingredients

  • 6 tbsp unsalted butter
  • ½ cup granulated sugar
  • 6 medium granny smith apples
  • 1.25 cups all-purpose flour
  • 3 tbsp cold unsalted butter, cubed
  • ¼ tsp salt
  • 4 tbsp ice water
  • 1 pint vanilla ice cream (optional, for serving)

Instructions

  1. 1

    Mix flour and salt. Cut in cold butter cubes until mixture resembles coarse sand.

  2. 2

    Add ice water 1 tbsp at a time, stirring until dough just comes together.

  3. 3

    Form dough into a disk, wrap in plastic, and refrigerate while you prep apples.

  4. 4

    Preheat oven to 400°F. Melt 6 tbsp butter with sugar in a 10-inch ovenproof skillet over medium heat.

  5. 5

    Peel, halve, and core the apples. Arrange cut-side down in the caramel, fitting them snugly.

  6. 6

    Cook on stovetop without stirring until the caramel is deep amber and edges of apples begin to soften, ~12 minutes.

  7. 7

    Roll pastry into a thin circle slightly larger than the skillet. Lay it over apples, tuck edges down around fruit.

  8. 8

    Bake until pastry is golden brown, ~20 minutes. Remove and let cool for 2 minutes.

  9. 9

    Place a serving plate over the skillet and flip in one confident motion. Lift the skillet away.

  10. 10

    Serve warm with vanilla ice cream if desired.

Tools you’ll need

  • 10-inch ovenproof cast iron skillet or heavy-bottomed oven-safe skillet
  • cutting board and knife
  • pastry blender or two forks
  • rolling pin
  • instant-read thermometer (optional, for caramel color check)
  • serving plate (larger than skillet diameter)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.