Custrd is out on the App Store — Download it free →
Back to recipes

Classic Apple Tarte Tatin

Buttery caramelized apples under a golden puff pastry crust, flipped to reveal a glossy, amber topping. A rustic French dessert that looks impressive but takes just 45 minutes start to finish.

Total time
45 min
Servings
6
Calories
385
Protein
3g
Classic Apple Tarte Tatin
elegantindulgentfrenchvegetariancrispytendercaramelizeddate-night

Ingredients

  • ½ cup butter
  • ½ cup granulated sugar
  • 8 medium apples (Granny Smith or Honeycrisp), peeled and halved
  • 1 tsp vanilla extract
  • 1 sheet (9 × 9 inch or similar) puff pastry, thawed if frozen
  • ¼ tsp salt

Instructions

  1. 1

    Preheat oven to 400°F. Pat apple halves dry with paper towels.

  2. 2

    In a 10-inch cast iron skillet, melt butter over medium-high heat, ~2 minutes.

  3. 3

    Add sugar and salt, stirring often, until caramel is amber and fragrant, ~4 minutes.

  4. 4

    Remove from heat. Arrange apple halves cut-side down in a tight spiral, fitting them snugly.

  5. 5

    Return to medium heat and cook apples without moving until caramel darkens, ~5 minutes.

  6. 6

    Drizzle vanilla extract over apples. Remove from heat and cool 2 minutes.

  7. 7

    Lay puff pastry over apples, tucking edges down inside the skillet rim.

  8. 8

    Bake until pastry is puffed and golden brown, 18–22 minutes.

  9. 9

    Cool 5 minutes. Run a thin knife around the edge, then invert onto a serving plate in one quick motion.

  10. 10

    Serve warm or at room temperature, ideally with crème fraîche or vanilla ice cream.

Tools you’ll need

  • 10-inch cast iron skillet
  • wooden spoon or heatproof spatula
  • measuring cups and spoons
  • paper towels
  • oven
  • thin-bladed knife
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.