CookSnap is coming soon — Join the waitlist →

Almond Croissants

Buttery, flaky croissants filled with almond cream and topped with sliced almonds and a light glaze. These French pastries require laminated dough but reward with restaurant-quality results.

Total time
55 min
Servings
4
Calories
385
Protein
8g
Almond Croissants
indulgentelegantfrenchvegetarianflakycrispytenderweekend

Ingredients

  • 3 oz unsalted butter, softened
  • 3 oz granulated sugar
  • 3 oz almond flour
  • ½ whole egg, large
  • 1 lb (about 8 croissants) croissant dough, thawed if frozen
  • 2 oz sliced almonds
  • 1 whole egg yolk
  • 2 tbsp apricot jam or honey
  • 1 tbsp water

Instructions

  1. 1

    Beat softened butter and sugar until pale and fluffy, about 2 minutes.

  2. 2

    Fold in almond flour and half egg until smooth.

  3. 3

    Preheat oven to 400°F (200°C). Line a large baking sheet with parchment paper.

  4. 4

    Unroll croissant dough and separate into individual croissants (or triangles if using a sheet).

  5. 5

    Spread 1 tbsp almond filling on the wider base of each croissant triangle.

  6. 6

    Roll from the base toward the point, then curve into a crescent shape.

  7. 7

    Place croissants point-side down on the baking sheet, leaving 2 inches between each.

  8. 8

    Whisk egg yolk with 1 tbsp water. Brush each croissant with egg wash.

  9. 9

    Press sliced almonds onto the tops, then bake until golden brown, 18–20 minutes.

  10. 10

    Heat jam with 1 tbsp water in a small saucepan until loose, about 1 minute.

  11. 11

    Brush warm glaze over hot croissants immediately after removing from oven.

  12. 12

    Cool on the baking sheet for 5 minutes, then transfer to a wire rack.

Tools you’ll need

  • electric mixer or whisk
  • mixing bowls (2)
  • baking sheet
  • parchment paper
  • small saucepan
  • pastry brush
  • wire rack

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.