CookSnap is coming soon — Join the waitlist →
Back to recipes

Warm Pain au Chocolat with Café Au Lait

Buttery, flaky pain au chocolat straight from the oven with melted chocolate center—no baking required. Serve with hot coffee and milk for an authentic French breakfast in under 20 minutes.

Total time
18 min
Servings
2
Calories
485
Protein
8g
Warm Pain au Chocolat with Café Au Lait
elegantcozyfrenchvegetarianvegetarianflakycrispymelty

Ingredients

  • 2 sheets frozen puff pastry sheets
  • 2 bars (1.75 oz each) dark chocolate bars (70% cacao)
  • 1 cup whole milk
  • ½ cup strong brewed espresso or dark roast coffee
  • ½ tbsp butter
  • 1 tsp sugar

Instructions

  1. 1

    Preheat oven to 400°F. Line a baking sheet with parchment paper.

  2. 2

    Thaw puff pastry sheets at room temperature for 5 minutes until pliable.

  3. 3

    Cut each chocolate bar into 2 long sticks. Lay one stick on each pastry.

  4. 4

    Roll each pastry tightly over the chocolate, sealing the edge with water.

  5. 5

    Place seam-side down on the baking sheet. Bake until golden, 12–14 minutes.

  6. 6

    Heat milk in a small saucepan over medium. Stir in butter and sugar.

  7. 7

    Pour hot coffee into a mug. Top with hot milk until nearly full.

  8. 8

    Transfer warm pain au chocolat to a plate. Serve with café au lait.

Tools you’ll need

  • baking sheet
  • parchment paper
  • small saucepan
  • mug
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.