CookSnap is in beta — Get it free on TestFlight →
Back to recipes

25-Min Crispy Butter Croissant Bake

Laminated croissant dough meets caramelized butter and fleur de sel in a sheet-pan finish that rivals the bakery. Golden, flaky layers crack under your fork with zero yeast-wait stress.

Total time
25 min
Servings
4
Calories
365
Protein
6g
25-Min Crispy Butter Croissant Bake
indulgentelegantfrenchvegetariancrispyflakybutteryweekend

Ingredients

  • 1 package (8 oz / ~225g, 4 croissants) frozen croissant dough sheets (all-butter)
  • 4 tbsp unsalted butter
  • 2 tbsp honey
  • ½ tsp fleur de sel or sea salt
  • 1 tbsp whole milk
  • 1 whole egg yolk
  • ¼ tsp vanilla extract
  • 1 tbsp turbinado sugar

Instructions

  1. 1

    Preheat oven to 400°F. Line a sheet pan with parchment. Thaw croissant dough slightly, ~5 min, until pliable but still cold.

  2. 2

    Cut each thawed croissant sheet into 4 triangles (or use pre-cut croissants). Arrange on the sheet pan, spacing 2 inches apart.

  3. 3

    Whisk egg yolk + milk + vanilla in a small bowl until glossy. Brush over croissant tops, then sprinkle turbinado sugar evenly.

  4. 4

    Bake 15–18 minutes until deep golden brown and crispy. Edges should look caramelized and smell buttery.

  5. 5

    While croissants bake, melt butter in a small saucepan over medium heat. Cook 3–4 min until it foams and turns amber; swirl in honey.

  6. 6

    Remove croissants from oven. Brush warm honey-butter over the tops immediately, then finish with a pinch of fleur de sel. Serve hot.

Tools you’ll need

  • sheet pan
  • parchment paper
  • small bowl
  • whisk
  • pastry brush
  • small saucepan
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.