20-Min Alfredo Chicken Basil Pizza
Store-bought pizza dough topped with creamy alfredo sauce, warm roasted chicken, and fresh basil — a weeknight pizza that tastes like it came from a wood-fired oven. Ready in 20 minutes, no fuss.
- Total time
- 20 min
- Servings
- 2
- Calories
- 580
- Protein
- 32g
comfortsimpleitalianchickencrispycreamytenderweeknight
Ingredients
- 1 lb (room temperature) pizza dough
- ¾ cup alfredo sauce
- 1 cup (shredded or cubed) roasted chicken
- ¼ cup (loosely packed, torn) fresh basil
Instructions
- 1
Preheat the oven to 475°F and lightly oil a large baking sheet.
- 2
Stretch the dough into a thin oval, then lay it on the sheet.
- 3
Spread alfredo sauce evenly over the dough, leaving a 0.5-inch border.
- 4
Scatter the roasted chicken across the sauce.
- 5
Bake until the crust is golden and crispy, about 10–12 minutes.
- 6
Remove from the oven and scatter fresh basil over the top.
Tools you’ll need
- oven
- large baking sheet
- spoon or spatula for spreading
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
