CookSnap is coming soon — Join the waitlist →
Back to recipes

Mongolian Beef

Tender beef seared until crispy, tossed in a ginger-soy glaze with chili heat and scallion brightness. One skillet, 20 minutes, tastes like takeout.

Total time
20 min
Servings
2
Calories
420
Protein
42g
Mongolian Beef
satisfyingquickchinesebeefcrispytenderweeknightmain-dish

Ingredients

  • 1 lb flank steak or sirloin, thinly sliced against the grain
  • 3 tbsp soy sauce
  • 1 tbsp ginger, minced
  • 1 whole fresh red chili, sliced thin (or 0.5 tsp chili flakes)
  • 1 tbsp brown sugar
  • 3 whole scallions, sliced into 1-inch pieces
  • 1 tsp sesame seeds

Instructions

  1. 1

    Heat 2 tbsp neutral oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  2. 2

    Working in two batches, sear the beef 90 seconds per side without stirring. Transfer to a plate.

  3. 3

    Pour off all but 1 tbsp oil. Add ginger and chili, cook 30 seconds until fragrant.

  4. 4

    Add soy sauce and brown sugar, stir until sugar dissolves and mixture bubbles, about 1 minute.

  5. 5

    Return beef to the skillet, toss with the glaze for 1 minute until coated and heated through.

  6. 6

    Remove from heat. Fold in scallions, sprinkle sesame seeds, serve immediately over rice.

Tools you’ll need

  • 12-inch skillet or wok
  • cutting board
  • sharp knife
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.