CookSnap is coming soon — Join the waitlist →

15-Min Veggie Bibimbap Bowl

Colorful vegetable bibimbap with gochujang sauce and a crispy fried egg, ready in 10 minutes. Cook rice ahead or use leftover—this bowl comes together on the stovetop.

Total time
15 min
Servings
2
Calories
385
Protein
11g
15-Min Veggie Bibimbap Bowl
quickfreshkoreanvegetarianeggscrispytenderweeknight

Ingredients

  • 2 cups cooked rice (white or brown)
  • 2 whole eggs
  • 2 tbsp gochujang (Korean red chili paste)
  • 1 tbsp sesame oil
  • 2 cups mixed vegetables (spinach, carrot, zucchini, mushrooms, thinly sliced)
  • 1 tbsp soy sauce
  • 1 tbsp sesame seeds

Instructions

  1. 1

    Mix gochujang with 1 tbsp water and 1 tsp sesame oil in a small bowl until smooth.

  2. 2

    Heat 1 tsp oil in a large skillet over medium-high heat, then add mixed vegetables.

  3. 3

    Sauté vegetables 3–4 minutes, stirring, until tender. Season with salt and pepper.

  4. 4

    Push vegetables to the side. Add remaining oil, then crack eggs into the pan and fry until whites set.

  5. 5

    Divide rice between two bowls. Top with sautéed vegetables and one fried egg per bowl.

  6. 6

    Drizzle gochujang sauce over each bowl, sprinkle sesame seeds, and serve immediately.

Tools you’ll need

  • 12-inch skillet
  • small bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.