CookSnap is coming soon — Join the waitlist →
Back to recipes

10-Min Bibimbap Rice Bowl

Cooked rice topped with sautéed spinach, mushrooms, a fried egg, and gochujang-sesame sauce. Ready in 10 minutes using pre-cooked rice and a single skillet.

Total time
10 min
Servings
2
Calories
385
Protein
12g
10-Min Bibimbap Rice Bowl
quicksatisfyingkoreanvegetarianeggscrispytenderweeknight

Ingredients

  • 1.5 cups cooked white or brown rice
  • 2 cups fresh baby spinach
  • 4 oz mushrooms, sliced
  • 2 tbsp gochujang (Korean red chili paste)
  • 1.5 tbsp sesame oil
  • 2 whole eggs

Instructions

  1. 1

    Stir gochujang with 1 tbsp sesame oil and 1 tbsp water in a small bowl until smooth.

  2. 2

    Heat 0.5 tbsp sesame oil in a large skillet over medium-high. Cook mushrooms, stirring occasionally, until golden, about 3 minutes.

  3. 3

    Add spinach to the skillet and stir until wilted, about 60 seconds. Transfer to a plate.

  4. 4

    Crack eggs into the same skillet. Cook until whites set but yolks still jiggle, about 3 minutes.

  5. 5

    Divide rice between two bowls. Top each with mushrooms, spinach, and a fried egg.

  6. 6

    Drizzle gochujang sauce over each bowl and serve immediately.

Tools you’ll need

  • 12-inch skillet
  • small bowl
  • two serving bowls
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.