CookSnap is coming soon — Join the waitlist →
Back to recipes

25-Min Bibimbap Rice Bowl

Warm rice topped with quick-cooked vegetables, crispy fried eggs, and gochujang-sesame sauce. A vegetable-forward Korean bowl that comes together in one skillet while rice cooks.

Total time
25 min
Servings
2
Calories
485
Protein
14g
25-Min Bibimbap Rice Bowl
satisfyingfreshkoreanvegetarianeggscrispytenderweeknight

Ingredients

  • 2 cups cooked white or brown rice
  • 3 tbsp gochujang (Korean red chili paste)
  • 2 tbsp sesame oil
  • 3 cups mixed vegetables (zucchini, carrots, mushrooms, spinach), thinly sliced or shredded
  • 2 whole eggs
  • 1 tbsp soy sauce
  • 1 tbsp rice vinegar or white vinegar

Instructions

  1. 1

    Stir together gochujang, 1 tbsp sesame oil, soy sauce, and vinegar in a small bowl. Set aside.

  2. 2

    Heat 0.5 tbsp sesame oil in a large skillet over medium-high heat until shimmering, about 60 seconds.

  3. 3

    Add vegetables in batches (harder ones like carrots first, delicate ones like spinach last), stirring, until tender-crisp, 5–6 minutes total.

  4. 4

    Push vegetables to the sides of the skillet and crack both eggs into the center. Fry until whites set but yolks still jiggle, 3–4 minutes.

  5. 5

    Divide rice between two bowls. Top each with half the vegetable-egg mixture, then drizzle with gochujang sauce.

  6. 6

    Serve immediately. Stir everything together before eating.

Tools you’ll need

  • large 10–12 inch nonstick or cast-iron skillet
  • small bowl
  • two serving bowls
  • spatula or wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.