CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Bibimbap Rice Bowl

Warm rice topped with sautéed veggies, a fried egg, and a spicy gochujang sauce. Toss it all together and eat straight from the bowl.

Total time
20 min
Servings
2
Calories
485
Protein
15g
20-Min Bibimbap Rice Bowl
comfortquickkoreanvegetarianeggscrispytenderweeknight

Ingredients

  • 2 cups cooked white or brown rice
  • 3 tbsp gochujang (Korean red chili paste)
  • 2 tbsp sesame oil
  • 1 medium zucchini, sliced 1/4-inch thick
  • 4 oz shiitake or cremini mushrooms, sliced
  • 2 cups spinach (fresh or frozen)
  • 2 whole eggs
  • 2 stalks scallions, sliced thin

Instructions

  1. 1

    Stir gochujang with 1 tbsp sesame oil, 1 tbsp soy sauce, and 1 tbsp water until smooth. Set aside.

  2. 2

    Heat 1/2 tbsp sesame oil in a large skillet over medium-high. Sauté zucchini and mushrooms until tender and lightly browned, about 5 minutes.

  3. 3

    Add spinach to the skillet and stir until wilted, about 1 minute. Transfer veggies to a plate.

  4. 4

    Add remaining 1/2 tbsp sesame oil to skillet. Crack both eggs into the pan and fry until whites set but yolks still jiggle, about 3 minutes.

  5. 5

    Divide warm rice between two bowls. Arrange sautéed veggies on top of each, then slide a fried egg into the center.

  6. 6

    Drizzle gochujang sauce over the bowl. Scatter scallions on top and toss everything together before eating.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon
  • two bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.