CookSnap is coming soon — Join the waitlist →
Back to recipes

15-Min Crispy Bacon Quiche

A skillet quiche with bacon, cheese, and eggs that bakes in one pan. Crunchy bacon, melty Gruyère, and a custardy center—weeknight dinner in 15 minutes.

Total time
18 min
Servings
4
Calories
380
Protein
26g
15-Min Crispy Bacon Quiche
comfortindulgentfrenchgluten-freeeggscreamycrispyweeknight

Ingredients

  • 6 slices bacon, chopped
  • 8 large eggs
  • ½ cup heavy cream
  • 1 cup Gruyère cheese, shredded
  • ¼ medium yellow onion, finely diced
  • 1 tbsp fresh thyme or chives, chopped

Instructions

  1. 1

    Preheat oven to 400°F. Cook bacon in a 10-inch cast iron skillet over medium-high until crispy, about 5 minutes. Transfer to a plate.

  2. 2

    Pour off most bacon fat, leaving about 1 tbsp. Add diced onion to the skillet and sauté until softened, 2–3 minutes.

  3. 3

    Whisk eggs and cream together in a bowl. Season with salt and pepper. Stir in cooked bacon, cheese, and thyme.

  4. 4

    Pour egg mixture into the skillet over the onions. Stir gently to distribute bacon and cheese evenly.

  5. 5

    Bake until the center is just set but still slightly jiggly when you shake the pan, 8–10 minutes.

  6. 6

    Let cool 2 minutes, then slice into wedges and serve hot from the skillet.

Tools you’ll need

  • 10-inch cast iron skillet
  • small bowl
  • whisk
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all French recipes →