Custrd is out on the App Store — Download it free →
Back to recipes

15-Min Pancit Bihon

Stir-fried rice noodles with chicken, shrimp, and vegetables finished with soy sauce and calamansi. A Filipino weeknight staple that hits the table in under 15 minutes.

Total time
15 min
Servings
4
Calories
385
Protein
28g
15-Min Pancit Bihon
comfortcasualfilipinochickenshrimptenderchewyweeknight

Ingredients

  • 8 oz rice noodles (bihon), dried
  • 8 oz boneless chicken breast, diced
  • 6 oz shrimp, peeled and deveined
  • 2 cups cabbage, sliced thin
  • 1 medium carrots, julienned
  • 3 tbsp soy sauce

Instructions

  1. 1

    Pour boiling water over rice noodles in a bowl and let sit 5 minutes until pliable. Drain and set aside.

  2. 2

    Heat 2 tbsp oil in a large skillet over medium-high heat until shimmering, about 1 minute.

  3. 3

    Add diced chicken, cook stirring often, until no pink remains, about 4 minutes.

  4. 4

    Toss in shrimp, carrots, and cabbage. Cook stirring, until shrimp turns opaque, about 3 minutes.

  5. 5

    Add drained noodles and soy sauce. Toss everything together for 1–2 minutes until heated through.

  6. 6

    Squeeze calamansi or lemon over top. Serve hot from the skillet.

Tools you’ll need

  • large skillet (12-inch)
  • bowl
  • wooden spoon or silicone spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.