CookSnap is coming soon — Join the waitlist →
Back to recipes

Xinjiang Beef Stir-Fry with Rice & Roasted Veggies

Tender beef with cumin and chili crisp, served over yellow rice with roasted broccoli, cauliflower, carrots, and pickled red cabbage. One-pan sear and one sheet pan roast for a complete Xinjiang-inspired dinner in under 30 minutes.

Total time
28 min
Servings
2
Calories
485
Protein
38g
Xinjiang Beef Stir-Fry with Rice & Roasted Veggies
satisfyingquickchinesebeeftendercrispyweeknightstir-fry

Ingredients

  • ¾ lb beef sirloin or flank steak, sliced 1/4-inch thin
  • 1.5 tsp ground cumin
  • 2 tbsp chili crisp (or sriracha)
  • 2 tbsp soy sauce
  • 1.5 cups yellow rice, cooked
  • 2 cups broccoli florets
  • 1.5 cups cauliflower florets
  • 1 cup carrots, sliced into 1/4-inch rounds
  • ½ cup pickled red cabbage

Instructions

  1. 1

    Heat oven to 425°F. Toss broccoli, cauliflower, and carrots with 2 tbsp oil, salt, and pepper. Spread on a sheet pan.

  2. 2

    Roast vegetables 15 minutes until edges brown and tender-crisp.

  3. 3

    While vegetables roast, toss beef with cumin, salt, and black pepper.

  4. 4

    Heat 2 tbsp oil in a large skillet over high heat until it shimmers, about 90 seconds.

  5. 5

    Add beef in a single layer and sear without stirring 2 minutes until a crust forms. Stir and cook 1 more minute until medium-rare inside.

  6. 6

    Remove from heat. Stir in chili crisp and soy sauce until coated.

  7. 7

    Divide yellow rice among plates. Top with stir-fried beef, roasted vegetables, and a spoonful of pickled cabbage on the side.

Tools you’ll need

  • sheet pan
  • 12-inch heavy skillet
  • cutting board and knife
  • large spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.