CookSnap is coming soon — Join the waitlist →
Back to recipes

Spicy Beef Stir-Fry with Noodles & Avocado

Hot-and-savory Thai beef with bell peppers and chili, served over rice vermicelli with creamy avocado and peanut sauce. One-pan weeknight dinner that hits in 20 minutes.

Total time
20 min
Servings
2
Calories
580
Protein
38g
Spicy Beef Stir-Fry with Noodles & Avocado
quicksatisfyingthaibeeftendercrispyweeknightstir-fry

Ingredients

  • ¾ lb beef sirloin or flank, thinly sliced
  • 1 whole red bell pepper, sliced into strips
  • 2 whole Thai red chili peppers or serrano, sliced
  • 3 tbsp soy sauce
  • 1 tbsp fish sauce
  • 4 oz rice vermicelli noodles
  • 1 whole avocado, sliced
  • ½ cup peanut sauce (jarred or homemade)

Instructions

  1. 1

    Cook rice vermicelli in boiling salted water until tender, about 4 minutes. Drain and set aside.

  2. 2

    Heat 2 tbsp oil in a large skillet over medium-high until shimmering, about 1 minute.

  3. 3

    Add beef in a single layer. Sear without stirring for 90 seconds, then flip and cook another 90 seconds until edges brown. Transfer to a plate.

  4. 4

    Add bell pepper and chili to the skillet. Stir-fry for 2 minutes until peppers soften and char slightly at the edges.

  5. 5

    Return beef to the pan. Pour in soy sauce and fish sauce, toss to coat. Cook 1 minute until the surface looks glossy.

  6. 6

    Divide noodles between two bowls. Top with beef and peppers, arrange avocado slices alongside, drizzle with peanut sauce, and serve with a lime wedge.

Tools you’ll need

  • large skillet (12-inch)
  • pot for boiling water
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.