Winter Melon Soup with Shrimp & Ham
Silky winter melon in a light, aromatic broth with tender shrimp and crispy ham. A classic Chinese comfort soup that feels fancy but takes 20 minutes.
- Total time
- 22 min
- Servings
- 4
- Calories
- 158
- Protein
- 22g
cozywholesomechineseshrimphamsilkytenderweeknight
Ingredients
- 1.5 lb winter melon, peeled and cubed
- ¾ lb shrimp, peeled and deveined
- ¼ lb diced ham (or Chinese sausage, sliced thin)
- 6 cups chicken or shrimp stock
- 3 slices ginger, peeled and sliced thin
- 0.3 oz dried mushrooms (shiitake or porcini), rinsed
- 2 tbsp Shaoxing wine (or dry sherry)
- 2 stalks green onions, sliced thin
Instructions
- 1
Bring stock to a boil in a large pot over high heat. Add ginger slices and dried mushrooms.
- 2
Add winter melon cubes and ham. Return to a boil, then reduce heat and simmer 8 minutes.
- 3
Pour in Shaoxing wine. Add shrimp and stir gently until they turn pink and opaque, about 3 minutes.
- 4
Taste and season with salt and white pepper. Ladle into bowls.
- 5
Garnish each bowl with sliced green onions. Serve hot.
Tools you’ll need
- large pot (at least 3-quart capacity)
- cutting board
- chef's knife
- wooden spoon or soup ladle
- small bowl for rinsing mushrooms
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
