CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Winter Melon Soup with Shrimp & Chicken

Delicate winter melon simmered in a savory broth with tender shrimp and chicken, finished with ginger and scallions. A light, restorative Chinese dinner that's naturally gluten-free.

Total time
45 min
Servings
4
Calories
185
Protein
28g
Winter Melon Soup with Shrimp & Chicken
wholesomelightchinesegluten-freeshrimpchickentendersilky

Ingredients

  • 1.5 lbs winter melon, peeled and cubed
  • ½ lb chicken breast, diced
  • ½ lb shrimp, peeled and deveined
  • 3 slices (1/4-inch thick) ginger, sliced
  • 6 cups chicken stock
  • 3 whole scallions, chopped
  • 1.5 tbsp soy sauce
  • 1 tsp sesame oil
  • 1 to taste salt and white pepper

Instructions

  1. 1

    Peel winter melon and remove seeds. Cut into 1-inch cubes; set aside.

  2. 2

    Cut chicken breast into 0.5-inch dice. Rinse shrimp under cold water.

  3. 3

    Bring stock to a boil in a large pot over high heat. Add ginger slices.

  4. 4

    Add diced chicken to boiling stock. Simmer 8 minutes until just cooked.

  5. 5

    Add winter melon cubes and shrimp. Simmer 4 minutes until shrimp turns opaque.

  6. 6

    Stir in soy sauce and sesame oil. Taste and adjust salt and white pepper.

  7. 7

    Transfer to bowls. Garnish with chopped scallions. Serve hot.

Tools you’ll need

  • large pot (4-quart minimum)
  • cutting board
  • chef's knife
  • wooden spoon
  • soup bowls
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.