CookSnap is coming soon — Join the waitlist →
Back to recipes

Warm Goat Cheese Toast Salad

Crispy baguette topped with melted goat cheese, served over peppery greens with a bright Dijon vinaigrette. Restaurant-simple and ready in 15 minutes.

Total time
15 min
Servings
2
Calories
380
Protein
12g
Warm Goat Cheese Toast Salad
elegantlightfrenchvegetariancheesecrispymeltytender

Ingredients

  • 4 cups mixed greens (arugula, baby spinach, or frisée)
  • 4 oz goat cheese, softened
  • ½ loaf baguette, sliced 1/2-inch thick
  • 1 tbsp Dijon mustard
  • 1 tbsp red wine vinegar
  • 1 small shallot, minced

Instructions

  1. 1

    Whisk Dijon, red wine vinegar, minced shallot, 3 tbsp olive oil, salt, and pepper in a bowl.

  2. 2

    Arrange baguette slices on a sheet pan and toast under the broiler until light gold, 2–3 minutes.

  3. 3

    Spread goat cheese evenly on each warm toast. Broil 1–2 minutes until edges bubble and top just softens.

  4. 4

    Toss greens with half the vinaigrette. Divide between two plates.

  5. 5

    Arrange warm toasts over greens. Drizzle remaining vinaigrette over the salad and serve immediately.

Tools you’ll need

  • sheet pan
  • broiler
  • small bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all French recipes →