Warm Goat Cheese Toast Salad
Crispy baguette topped with melted goat cheese, served over peppery greens with a bright Dijon vinaigrette. Restaurant-simple and ready in 15 minutes.
- Total time
- 15 min
- Servings
- 2
- Calories
- 380
- Protein
- 12g

elegantlightfrenchvegetariancheesecrispymeltytender
Ingredients
- 4 cups mixed greens (arugula, baby spinach, or frisée)
- 4 oz goat cheese, softened
- ½ loaf baguette, sliced 1/2-inch thick
- 1 tbsp Dijon mustard
- 1 tbsp red wine vinegar
- 1 small shallot, minced
Instructions
- 1
Whisk Dijon, red wine vinegar, minced shallot, 3 tbsp olive oil, salt, and pepper in a bowl.
- 2
Arrange baguette slices on a sheet pan and toast under the broiler until light gold, 2–3 minutes.
- 3
Spread goat cheese evenly on each warm toast. Broil 1–2 minutes until edges bubble and top just softens.
- 4
Toss greens with half the vinaigrette. Divide between two plates.
- 5
Arrange warm toasts over greens. Drizzle remaining vinaigrette over the salad and serve immediately.
Tools you’ll need
- sheet pan
- broiler
- small bowl
- whisk
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



