CookSnap is coming soon — Join the waitlist →
Back to recipes

Vietnamese Vegetable Fried Rice

Fragrant jasmine rice tossed with carrots, peas, and scallions in a wok, finished with soy sauce and sesame oil. Light, satisfying, and ready in 15 minutes.

Total time
15 min
Servings
2
Calories
320
Protein
6g
Vietnamese Vegetable Fried Rice
quicksimplevietnamesevegetarianveganveganfluffytender

Ingredients

  • 2 cups cooked jasmine rice, chilled or at room temperature
  • 1 medium carrots, peeled
  • ¾ cup frozen peas
  • 3 stalks scallions
  • 2 tablespoons soy sauce
  • 1 tablespoon sesame oil

Instructions

  1. 1

    Place the carrot on a cutting board with the pointy end away from you. Slice it crosswise into thin coins about 1/8-inch thick, like slicing a pencil into discs.

  2. 2

    Hold a scallion on the cutting board and slice it crosswise into 1/4-inch pieces, from the white root end all the way through the green top, like cutting green onion rings.

  3. 3

    Repeat with the remaining 2 scallions.

  4. 4

    Set a large skillet or wok over medium-high heat and wait 1 minute until the bottom feels hot when you hold your hand briefly above it (about 2 inches up).

  5. 5

    Pour 2 tablespoons of neutral oil into the hot pan, then swirl it to coat the bottom evenly; the oil should shimmer and slide quickly when you tilt the pan.

  6. 6

    Add the carrot coins and stir them constantly for 2 minutes until they soften slightly and the edges turn golden.

  7. 7

    Pour in the frozen peas and stir everything together for 1 minute until the peas are no longer icy and the pan is very hot again.

  8. 8

    Add all 2 cups of the cooked rice to the pan, breaking up any clumps with the back of a wooden spoon as you stir.

  9. 9

    Stir everything together over medium-high heat for 2 minutes until the rice is heated through and grains are separated, not clumped together.

  10. 10

    Pour in the 2 tablespoons of soy sauce and stir for 30 seconds until the rice is evenly coated and the pan smells savory.

  11. 11

    Drizzle the 1 tablespoon of sesame oil over the rice and stir for 20 seconds until you no longer see any oil pooling at the bottom.

  12. 12

    Remove the skillet from heat, then scatter all the scallion pieces on top of the rice.

Tools you’ll need

  • 14-inch wok or large skillet
  • wooden spoon
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.