CookSnap is coming soon — Join the waitlist →
Back to recipes

Vietnamese Lemongrass Shrimp with Rice Vermicelli

Charred shrimp tossed with fresh lemongrass, garlic, and chili over cool rice vermicelli and peanut sauce. Ready in 15 minutes — the kind of bright, garlicky dinner that feels like takeout but tastes homemade.

Total time
15 min
Servings
2
Calories
385
Protein
32g
Vietnamese Lemongrass Shrimp with Rice Vermicelli
freshquickvietnameseshrimpcrispytenderweeknightbowl

Ingredients

  • 1 lb shrimp, peeled and deveined
  • 3 stalks lemongrass stalks, white and light green parts, minced
  • 4 cloves garlic, minced
  • 1 whole red chili, thinly sliced (or 0.5 tsp red pepper flakes)
  • 2 tbsp fish sauce
  • 6 oz rice vermicelli (dried)
  • ½ cup peanut sauce (jarred or homemade)

Instructions

  1. 1

    Boil salted water in a pot. Add rice vermicelli and cook 4 minutes until tender. Drain, rinse with cool water, and divide between two bowls.

  2. 2

    Heat 2 tbsp oil in a large skillet over high heat until shimmering, about 90 seconds.

  3. 3

    Add lemongrass, garlic, and chili. Cook 30 seconds, stirring constantly, until fragrant.

  4. 4

    Add shrimp and fish sauce. Stir constantly for 3–4 minutes until shrimp turn pink and edges begin to char.

  5. 5

    Divide shrimp and aromatics between the two bowls over the vermicelli.

  6. 6

    Drizzle peanut sauce over each bowl and serve immediately.

Tools you’ll need

  • large pot
  • 12-inch skillet
  • wooden spoon or spatula
  • knife and cutting board
  • two bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Vietnamese recipes →