5-Min Veggie Naan Pizza
Crispy naan topped with pizza sauce, melted mozzarella, and caramelized bell pepper — ready in 5 minutes. The fastest weeknight dinner that still feels like pizza.
- Total time
- 5 min
- Servings
- 2
- Calories
- 385
- Protein
- 14g
quickcasualitalianvegetariancrispymeltyweeknightpizza
Ingredients
- 2 pieces naan
- ½ cup pizza sauce
- 1 large bell pepper
- 1 cup mozzarella cheese, shredded
Instructions
- 1
Slice bell pepper into thin rings, removing the seeds.
- 2
Spread 2 tablespoons pizza sauce on each naan, leaving a 1/2-inch border.
- 3
Top with pepper rings, then sprinkle mozzarella evenly over each naan.
- 4
Broil 4 inches from heat until cheese bubbles and edges char, 2–3 minutes.
- 5
Serve immediately while cheese is melted and edges are still warm.
Tools you’ll need
- cutting board
- sharp knife
- baking sheet
- broiler
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
