CookSnap is coming soon — Join the waitlist →

Vegetarian Bungeoppang (Korean Corn Dogs)

Crispy, chewy Korean-style corn dogs stuffed with mozzarella and potato—served with sweet and spicy dipping sauces. A fun, shareable snack that's golden and irresistible straight from the oil.

Total time
40 min
Servings
2
Calories
620
Protein
14g
Vegetarian Bungeoppang (Korean Corn Dogs)
indulgentcasualkoreanvegetariancheesecrispychewymelty

Ingredients

  • 2 whole medium waxy potatoes
  • 4 oz mozzarella cheese, low-moisture
  • ¾ cup all-purpose flour
  • ¾ cup cornstarch
  • ½ tsp baking powder
  • 1 whole egg
  • 2 cups vegetable oil, for frying
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Boil the 2 potatoes in a large pot of salted water over high heat until a fork pierces the center with no resistance, about 15 minutes.

  2. 2

    Drain the potatoes and let them cool until you can hold them without burning your fingers, about 5 minutes.

  3. 3

    Cut the mozzarella block lengthwise into 4 sticks, each about the size of an adult pinky finger.

  4. 4

    Peel the cooled potatoes by rubbing them under cold running water until the skin slides off, then cut each potato in half lengthwise.

  5. 5

    Using a small spoon, scoop out a narrow channel down the center of each potato half, leaving about 1/4 inch of flesh on all sides.

  6. 6

    Push one mozzarella stick into the hollow channel of each potato half, pressing gently so it sits snug inside.

  7. 7

    In a shallow bowl, whisk together 0.75 cup flour, 0.75 cup cornstarch, 0.5 tsp baking powder, and a pinch each of salt and pepper until no lumps remain.

  8. 8

    In another small bowl, beat the 1 egg with 0.25 cup water, stirring until the mixture is uniform and pale yellow.

  9. 9

    Pour the egg mixture into the flour mixture and stir with a fork until a thick, pancake-like batter forms with no dry flour visible.

  10. 10

    Pour 2 cups vegetable oil into a medium saucepan and heat over medium-high heat until it shimmers and a wooden spoon dipped in it bubbles gently, about 3 minutes.

  11. 11

    Using tongs, dip one potato-cheese piece into the batter, rolling it to coat all sides thickly, then carefully lower it into the hot oil.

  12. 12

    Fry for 2 to 3 minutes until the coating turns golden brown and is crispy when you tap it with a wooden spoon.

  13. 13

    Remove the bungeoppang with a slotted spoon and place it on a plate lined with paper towels to drain excess oil.

  14. 14

    Repeat steps 11–13 with the remaining 3 potato-cheese pieces, working with one piece at a time.

  15. 15

    Arrange the 4 bungeoppang on a serving plate, standing upright if possible, and serve immediately while the exterior is still warm and crispy.

Tools you’ll need

  • large pot
  • colander
  • sharp paring knife
  • cutting board
  • small spoon
  • shallow bowl
  • whisk
  • fork
  • medium saucepan
  • tongs
  • slotted spoon
  • paper towels
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.