CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Pissaladière

A Provençal pizza-like tart topped with caramelized onions, anchovies, and olives. Crispy, savory, and utterly addictive—ready in under 50 minutes with store-bought puff pastry.

Total time
45 min
Servings
4
Calories
385
Protein
9g
Pissaladière
rusticelegantfrenchmediterraneanfishcrispytenderweeknight

Ingredients

  • 1 sheet puff pastry sheet (thawed)
  • 1.5 lb yellow onions, thinly sliced
  • 3 tbsp olive oil
  • 2 cloves garlic cloves, minced
  • 1 pinch salt and pepper
  • 12 fillets anchovy fillets, drained
  • ¾ cup Niçoise olives, pitted
  • 1 tsp fresh thyme leaves
  • ½ tbsp lemon juice

Instructions

  1. 1

    Preheat oven to 400°F. Place puff pastry sheet on a parchment-lined baking sheet.

  2. 2

    Prick the pastry all over with a fork to prevent puffing.

  3. 3

    Heat olive oil in a large skillet over medium. Add sliced onions and cook, stirring occasionally, until golden and very soft, 25–30 minutes.

  4. 4

    Add minced garlic to the onions and cook for 1 minute until fragrant.

  5. 5

    Remove from heat. Stir in lemon juice, salt, and pepper to taste.

  6. 6

    Spread caramelized onions evenly over the pastry, leaving a 1/2-inch border.

  7. 7

    Arrange anchovy fillets in a crosshatch pattern over the onions.

  8. 8

    Scatter olives and thyme over the top.

  9. 9

    Bake for 12–15 minutes until the pastry edges are golden brown and crispy.

  10. 10

    Cool for 2 minutes. Cut into squares and serve warm or at room temperature.

Tools you’ll need

  • baking sheet
  • parchment paper
  • fork
  • large skillet
  • wooden spoon
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.