CookSnap is coming soon — Join the waitlist →

Endive & Blue Cheese Salad

Crisp Belgian endive paired with creamy blue cheese, toasted walnuts, and a classic shallot vinaigrette. A elegant French bistro salad ready in under 15 minutes.

Total time
12 min
Servings
2
Calories
320
Protein
12g
Endive & Blue Cheese Salad
elegantlightfrenchvegetariancheesecrispycreamyweeknight

Ingredients

  • 2 heads Belgian endive, white or red
  • ¼ cup walnuts, chopped
  • ¾ cup blue cheese, crumbled
  • 1 small shallot, minced
  • 1.5 tbsp sherry vinegar
  • 3 tbsp olive oil

Instructions

  1. 1

    Toast walnuts in a dry skillet over medium heat, stirring often, until fragrant and lightly golden, 3-4 minutes. Transfer to a plate.

  2. 2

    Slice endive crosswise into 1-inch pieces, keeping the base intact so leaves stay together.

  3. 3

    Whisk shallot, sherry vinegar, salt, and pepper together in a small bowl.

  4. 4

    Slowly drizzle in olive oil while whisking until emulsified and smooth.

  5. 5

    Arrange endive on two plates. Drizzle with vinaigrette, then scatter blue cheese and toasted walnuts over top.

  6. 6

    Serve immediately while endive is crisp.

Tools you’ll need

  • 12-inch skillet
  • cutting board
  • chef's knife
  • small bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.