CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Cottage Cheese Strudel (Túrós Rétes)

Crispy phyllo sheets stuffed with sweet cottage cheese, sour cream, and raisins — a Hungarian classic that bakes golden in under 25 minutes. Serve warm with a dusting of powdered sugar for a bakery-quality dinner or brunch.

Total time
24 min
Servings
4
Calories
385
Protein
12g
Cottage Cheese Strudel (Túrós Rétes)
comfortwholesomehungarianvegetariancheesecrispycreamyweeknight

Ingredients

  • 8 sheets phyllo dough sheets
  • 1.5 cups cottage cheese
  • ½ cup sour cream
  • ⅓ cup raisins
  • 3 tbsp granulated sugar
  • 6 tbsp butter, melted
  • 2 tbsp powdered sugar for dusting

Instructions

  1. 1

    Preheat oven to 375°F. Mix cottage cheese, sour cream, granulated sugar, and raisins in a bowl until combined.

  2. 2

    Lay out 1 phyllo sheet on a work surface and brush lightly with melted butter.

  3. 3

    Repeat layering and buttering until you have 4 phyllo sheets stacked.

  4. 4

    Spread half the cottage cheese filling across the phyllo 2 inches from the bottom edge, leaving a 1-inch border on sides.

  5. 5

    Roll tightly from the bottom, tucking in the sides as you go. Transfer seam-side down to a buttered baking sheet.

  6. 6

    Repeat with remaining 4 phyllo sheets and filling to make a second roll. Brush both rolls with remaining butter.

  7. 7

    Bake 18–20 minutes until golden brown and edges curl. Dust with powdered sugar and serve warm.

Tools you’ll need

  • 9x13-inch baking sheet
  • mixing bowl
  • pastry brush
  • work surface

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.