CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Quick Cheese Strudel (Túrós Rétes)

Crispy phyllo wraps creamy cottage cheese and sugar into a warm, shatteringly crisp pastry — Hungarian comfort in under 25 minutes. No yeast dough required.

Total time
22 min
Servings
4
Calories
320
Protein
9g
Quick Cheese Strudel (Túrós Rétes)
comfortcozyhungarianvegetariancheesecrispycreamyweeknight

Ingredients

  • 1.5 cups cottage cheese (or ricotta)
  • 3 tbsp granulated sugar
  • 1 large egg
  • 8 sheets phyllo dough sheets (thawed)
  • 4 tbsp melted butter
  • ½ tsp vanilla extract
  • 1 tbsp powdered sugar (for dusting)

Instructions

  1. 1

    Mix cottage cheese, granulated sugar, egg, and vanilla in a bowl until smooth.

  2. 2

    Lay one phyllo sheet on a work surface, brush lightly with melted butter.

  3. 3

    Repeat layering and buttering 3 more phyllo sheets, then spread half the cheese mixture along one long edge.

  4. 4

    Roll tightly into a log, tucking in the sides. Transfer to a buttered baking sheet seam-side down.

  5. 5

    Repeat with remaining phyllo, butter, and cheese filling to make a second roll.

  6. 6

    Brush rolls with remaining butter. Bake at 400°F for 12–14 minutes until deep golden.

  7. 7

    Cool 2 minutes. Dust with powdered sugar and serve warm.

Tools you’ll need

  • mixing bowl
  • pastry brush
  • work surface (cutting board or clean counter)
  • baking sheet
  • butter knife or small offset spatula
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.