CookSnap is coming soon — Join the waitlist →

Trofie con Fagiolini e Patate

Creamy, rustic pasta with tender green beans and potatoes finished with garlic and olive oil. A humble Sicilian classic that's ready in under 30 minutes.

Total time
25 min
Servings
4
Calories
520
Protein
16g
Trofie con Fagiolini e Patate
comfortrusticitalianvegetarianvegetariantendercreamyweeknight

Ingredients

  • 1 lb trofie pasta
  • ½ lb waxy potatoes (Yukon gold), unpeeled
  • ¾ lb green beans, trimmed
  • 4 garlic cloves, minced
  • ⅓ cup olive oil
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Cut potatoes into 1/2-inch cubes. Cut green beans into 2-inch pieces.

  2. 2

    Bring a large pot of salted water to a boil. Add potatoes and cook 6 minutes.

  3. 3

    Add green beans and pasta to the pot. Stir and boil until pasta is al dente, ~9 minutes.

  4. 4

    While pasta cooks, heat olive oil in a small pan over medium. Add garlic and sauté until fragrant, ~2 minutes.

  5. 5

    Drain pasta, potatoes, and beans, reserving 1 cup pasta water.

  6. 6

    Pour garlic oil over pasta. Add 0.5 cup pasta water and toss gently until silky, adding more water if dry.

  7. 7

    Season with salt and pepper. Serve hot.

Tools you’ll need

  • large pot
  • small saucepan
  • cutting board
  • knife
  • colander
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.