CookSnap is coming soon — Join the waitlist →
Back to recipes

Pasta, Potatoes & Provola

Silky pasta and tender potatoes tossed with melty provola cheese, garlic, and black pepper in this rustic Southern Italian classic. Ready in under 30 minutes.

Total time
25 min
Servings
4
Calories
520
Protein
18g
Pasta, Potatoes & Provola
comfortrusticitalianvegetariancheesecreamytenderweeknight

Ingredients

  • 12 oz waxy potatoes (yukon gold or red)
  • 10 oz short pasta (ditalini or rigatoni)
  • 6 oz provola cheese, diced
  • 3 cloves garlic cloves, minced
  • 3 tbsp olive oil
  • 1 pinch salt and black pepper to taste
  • 2 tbsp fresh parsley, chopped (optional)

Instructions

  1. 1

    Cut potatoes into 1/2-inch cubes. Bring a large pot of salted water to boil.

  2. 2

    Add potatoes to boiling water. Cook for 5 minutes, stirring occasionally.

  3. 3

    Add pasta to the same pot with potatoes. Stir and cook until pasta is al dente, ~10 minutes.

  4. 4

    Reserve 1 cup pasta cooking water, then drain pasta and potatoes well.

  5. 5

    Heat olive oil in the pot over medium heat. Add garlic, cook 30 seconds until fragrant.

  6. 6

    Return pasta and potatoes to pot. Add provola cheese and stir constantly for 1 minute until melted.

  7. 7

    Add reserved pasta water 1/4 cup at a time, stirring, until creamy. Season with salt and pepper.

  8. 8

    Serve hot, garnished with parsley if desired.

Tools you’ll need

  • large pot
  • wooden spoon
  • colander
  • chef's knife
  • cutting board
  • measuring spoons
  • measuring cup

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.