CookSnap is coming soon — Join the waitlist →
Back to recipes

Tororo Soba — Cold Noodles with Yam & Egg

Silky buckwheat noodles chilled and served with grated mountain yam, raw egg yolk, and a tangy dipping sauce. Ready in under 15 minutes—no cooking skill required.

Total time
12 min
Servings
2
Calories
380
Protein
14g
Tororo Soba — Cold Noodles with Yam & Egg
lightrefreshingjapanesevegetarianeggssilkycreamyweeknight

Ingredients

  • 200 g soba noodles (dried buckwheat)
  • 3 tbsp soy sauce
  • 1.5 tbsp mirin (sweet rice wine)
  • ½ cup dashi stock (or water with 1 tsp instant dashi powder)
  • 100 g mountain yam (nagaimo or daikon radish as substitute), peeled
  • 2 whole large eggs

Instructions

  1. 1

    Bring a large pot of salted water to a rolling boil.

  2. 2

    Add soba noodles and stir gently. Cook until al dente, about 4–5 minutes; drain and rinse under ice-cold water until completely chilled.

  3. 3

    While noodles cook, combine soy sauce, mirin, and dashi in a small bowl; stir until sugar dissolves. Chill in the fridge.

  4. 4

    Using a microplane or grater, grate the yam into fine threads over a small bowl.

  5. 5

    Carefully separate each egg; place one yolk in a small cup for each serving.

  6. 6

    Divide chilled noodles between two bowls. Top each with grated yam and a raw egg yolk. Pour dipping sauce into small cups on the side; dip and eat.

Tools you’ll need

  • large pot
  • wooden spoon or pasta fork
  • colander
  • small mixing bowl
  • microplane or fine grater
  • small serving cups or bowls
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.