CookSnap is coming soon — Join the waitlist →

20-Min Tempura Soba with Shrimp & Crispy Veg

Buckwheat noodles in a hot dashi broth topped with crispy shrimp and vegetable tempura, plus cool grated daikon. Restaurant-quality in under 20 minutes using a dashi-paste shortcut.

Total time
20 min
Servings
2
Calories
520
Protein
24g
20-Min Tempura Soba with Shrimp & Crispy Veg
satisfyingelegantjapaneseshrimpcrispytenderchewyweeknight

Ingredients

  • 8 oz soba noodles (buckwheat)
  • 8 oz large shrimp, peeled & deveined
  • 2 cups vegetables for tempura (zucchini, shiitake, sweet potato)
  • 2 tsp dashi paste or instant dashi powder
  • ¾ cup all-purpose flour
  • ½ cup daikon radish, finely grated
  • 3 cups neutral oil for deep frying

Instructions

  1. 1

    Bring a pot of salted water to a boil. Add soba noodles and cook until tender, ~4 minutes. Drain, rinse briefly with cold water, and set aside.

  2. 2

    In the same pot, bring 4 cups water to a boil. Whisk in dashi paste until dissolved. Season lightly with salt—dashi carries enough umami.

  3. 3

    Heat oil in a deep skillet to 350°F (test by dropping a flour pinch—it should sizzle immediately). Pat shrimp and veg dry on paper towels.

  4. 4

    Mix flour with cold water to form a thin batter (no lumps needed—rustic batter is fine). Dip shrimp and vegetables, then fry 2-3 minutes until golden and crispy. Drain on paper towels.

  5. 5

    Divide cooked soba between two bowls. Ladle hot dashi over the noodles until half-full. Top with crispy tempura and a mound of grated daikon.

  6. 6

    Serve immediately. Dip tempura or noodles into the dashi before eating—the daikon cuts the richness of the fried coating.

Tools you’ll need

  • large pot
  • deep skillet or small wok
  • instant-read thermometer or deep-fry thermometer
  • slotted spoon or spider strainer
  • paper towels
  • two serving bowls
  • microplane or box grater for daikon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.