CookSnap is coming soon — Join the waitlist →
Back to recipes

25-Min Tempura Soba with Shrimp & Veggies

Crispy-fried shrimp and vegetables over chewy buckwheat noodles in a warm dashi-inspired broth. A restaurant-quality dinner that feels fast because the frying is the only real time commitment.

Total time
25 min
Servings
2
Calories
620
Protein
18g
25-Min Tempura Soba with Shrimp & Veggies
satisfyingcomfortjapaneseshrimpcrispychewytenderweeknight

Ingredients

  • 6 oz soba noodles (buckwheat)
  • 8 count large shrimp, peeled and deveined
  • 1.5 cups mixed vegetables for tempura (zucchini, bell pepper, mushroom)
  • ¾ cup all-purpose flour, divided
  • 2 cups dashi broth or vegetable broth
  • 3 tbsp soy sauce
  • 2 cups neutral oil for frying (vegetable or canola)

Instructions

  1. 1

    Heat oil to 350°F in a heavy-bottomed pot or deep skillet using a thermometer. Pat shrimp and vegetables completely dry.

  2. 2

    Mix 0.5 cup flour with cold water to make a thin batter the consistency of heavy cream. Season with a pinch of salt.

  3. 3

    Dredge shrimp and vegetables lightly in remaining flour, then dip into batter and drop carefully into hot oil. Fry in batches without crowding.

  4. 4

    Cook until golden and crispy, 2-3 minutes per batch. Lift out with a slotted spoon onto a paper-towel-lined plate.

  5. 5

    Boil soba noodles in salted water until al dente, about 4 minutes. Drain and divide between two bowls.

  6. 6

    Heat broth with soy sauce until steaming, then pour over noodles. Top with hot tempura and serve immediately.

Tools you’ll need

  • heavy-bottomed pot or deep 12-inch skillet
  • instant-read thermometer
  • slotted spoon
  • paper towels
  • two bowls
  • small mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Japanese recipes →