CookSnap is coming soon — Join the waitlist →

Tanuki Udon

Chewy udon noodles topped with crispy tempura bits, tangy sweet sauce, and scallions. A vegetarian Japanese classic ready in 25 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
12g
Tanuki Udon
comfortcasualjapanesevegetarianvegetarianchewycrispyweeknight

Ingredients

  • 8 oz udon noodles, fresh or frozen
  • ½ cup tempura flakes (tenkasu)
  • 3 tbsp soy sauce
  • 2 tbsp mirin
  • 3 cups dashi or vegetable broth
  • 3 tbsp scallions, chopped into 1/4-inch pieces

Instructions

  1. 1

    Bring a large pot of water to a rolling boil over high heat — you'll see vigorous bubbles breaking the surface continuously, about 8 minutes.

  2. 2

    Add the udon noodles to the boiling water and stir with a chopstick or fork to separate them, then cook until tender, about 3 minutes for frozen or 2 minutes for fresh.

  3. 3

    Drain the noodles in a colander, pressing gently with a spoon to remove excess water, then divide them between two bowls.

  4. 4

    Pour the dashi or broth into a small saucepan and set it over medium-high heat until it steams and small bubbles form around the edge, about 3 minutes.

  5. 5

    Add the soy sauce and mirin to the hot broth, stir for 10 seconds until combined, then divide the hot broth between the two bowls of noodles.

  6. 6

    Sprinkle half of the tempura flakes (about 1/4 cup) on top of each bowl of noodles and broth.

  7. 7

    Scatter the chopped scallions (about 1.5 tablespoons on each bowl) over the tempura flakes, then serve immediately while the broth is hot.

Tools you’ll need

  • large pot
  • colander
  • chopstick or fork
  • small saucepan
  • spoon
  • two bowls
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.