Custrd is out on the App Store — Download it free →
Back to recipes

Tamago Kake Gohan with Nori

A comforting Japanese rice bowl with a raw egg stirred into hot rice, seasoned with soy sauce and topped with nori and sesame seeds.

Total time
5 min
Servings
1
Calories
350
Protein
12g
Tamago Kake Gohan with Nori
comfortingquickJapanesedairy-freeeggcreamychewyweeknight

Ingredients

  • 1 cup cooked short-grain rice
  • 1 large egg
  • 1 tsp soy sauce
  • 1 sheet nori (dried seaweed)
  • ½ tsp sesame seeds

Instructions

  1. 1

    Place the 1 cup hot cooked rice in a bowl. The rice should be steaming hot, as the heat will gently cook the egg.

  2. 2

    Crack the 1 large egg directly over the rice. Use a fork or chopsticks to quickly stir the egg into the rice until it is well combined and the rice becomes creamy and slightly glossy.

  3. 3

    Drizzle the 1 tsp soy sauce over the egg-rice mixture and stir again to distribute evenly. The rice should turn a light golden brown.

  4. 4

    Tear the 1 sheet nori into small pieces and scatter them over the top of the rice.

  5. 5

    Sprinkle the 0.5 tsp sesame seeds over the nori. Serve immediately while the rice is still warm.

Tools you’ll need

  • bowl
  • fork or chopsticks

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.