CookSnap is coming soon — Join the waitlist →
Back to recipes

Tahini Buddha Bowl

Warm quinoa base topped with roasted chickpeas, cucumber, and cherry tomatoes, finished with a creamy tahini-lemon sauce. Ready in under 30 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
14g
Tahini Buddha Bowl
wholesomelightmediterraneanvegetarianveganchickpeascreamycrunchy

Ingredients

  • 1 cup quinoa
  • 1 can (15 oz) canned chickpeas, drained
  • 3 tbsp tahini
  • 1 whole lemon, juiced
  • 1.5 cups cherry tomatoes
  • 1 medium cucumber

Instructions

  1. 1

    Rinse quinoa. Bring 2 cups water to a boil, add quinoa, cover, reduce heat to low.

  2. 2

    Pat chickpeas dry. Toss with 1 tbsp olive oil, 0.5 tsp salt, and 0.25 tsp pepper.

  3. 3

    Spread chickpeas on a small sheet pan. Roast at 400°F until edges crisp, ~12 minutes.

  4. 4

    Whisk tahini with lemon juice, 2 tbsp water, 1 minced garlic clove, 0.25 tsp salt until smooth.

  5. 5

    Halve tomatoes. Slice cucumber into half-moons.

  6. 6

    Fluff cooked quinoa. Divide between bowls. Top with chickpeas, tomatoes, cucumber, and drizzle with tahini sauce.

Tools you’ll need

  • small saucepan with lid
  • small sheet pan
  • cutting board
  • chef's knife
  • whisk
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.