CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Quinoa Buddha Bowl with Tahini Dressing

Protein-packed quinoa base topped with roasted chickpeas, crisp vegetables, and a creamy tahini dressing. Build it fresh in under 25 minutes.

Total time
25 min
Servings
2
Calories
480
Protein
14g
Quinoa Buddha Bowl with Tahini Dressing
wholesomefreshmediterraneanvegetarianveganchickpeasfluffycrunchy

Ingredients

  • 1 cup quinoa
  • 1 can (15 oz) chickpeas, canned and drained
  • 3 tbsp olive oil
  • 1 medium sweet potato
  • 2 cups baby spinach
  • 2 tbsp tahini
  • ½ piece lemon (juiced)
  • 1 to taste salt and pepper

Instructions

  1. 1

    Rinse quinoa under cold water. Boil in salted water until fluffy and liquid absorbs, ~15 minutes.

  2. 2

    Cut sweet potato into 1/2-inch cubes. Pat chickpeas dry with a clean kitchen towel.

  3. 3

    Toss chickpeas with 1.5 tbsp olive oil, salt, and pepper. Spread on a sheet pan.

  4. 4

    Roast chickpeas at 425°F until crispy and golden, ~12 minutes, shaking halfway through.

  5. 5

    Heat 1.5 tbsp olive oil in a skillet over medium-high. Add sweet potato cubes.

  6. 6

    Cook sweet potato until edges soften and char, ~8 minutes, stirring occasionally.

  7. 7

    Whisk tahini with lemon juice and 2 tbsp water until pourable. Season with salt and pepper.

  8. 8

    Divide quinoa between bowls. Add sweet potato and chickpeas. Top with fresh spinach.

  9. 9

    Drizzle tahini dressing over the top. Serve immediately.

Tools you’ll need

  • small saucepan with lid
  • sheet pan
  • 12-inch skillet
  • 2 medium bowls
  • small whisk
  • kitchen towel

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.