20-Min Taco Stuffed Peppers
Halved bell peppers stuffed with seasoned ground beef and melted cheddar, baked until tender. Ready in 20 minutes — the weeknight dinner that feels like you tried.
- Total time
- 20 min
- Servings
- 4
- Calories
- 315
- Protein
- 26g
comfortamericanbeeftendermeltyweeknightmain-dishdinner
Ingredients
- 4 whole bell peppers
- 1 lb ground beef
- 1 packet taco seasoning
- 1 cup cheddar cheese, shredded
Instructions
- 1
Halve the peppers lengthwise, remove seeds and stems, and arrange cut-side up in a baking dish.
- 2
Brown the ground beef in a skillet over medium-high heat, breaking it up with a spoon, ~5 minutes.
- 3
Stir the taco seasoning and 1/4 cup water into the beef, then simmer 2 minutes until fragrant.
- 4
Divide the beef mixture among the pepper halves and top each with a pinch of cheddar cheese.
- 5
Bake at 400°F for 10 minutes until peppers soften and cheese melts.
Tools you’ll need
- 8x8-inch baking dish
- 12-inch skillet
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
