Sweet Chili Salmon with Lime
Glazed salmon with sweet chili sauce and a squeeze of lime, baked until flaky in under 20 minutes. Serve with mashed potatoes, sautéed spinach, and roasted peppers for a complete weeknight dinner.
- Total time
- 18 min
- Servings
- 2
- Calories
- 320
- Protein
- 36g
simplequickamericansalmonflakytenderweeknightmain-dish
Ingredients
- 2 6-oz fillets salmon fillet
- ⅓ cup sweet chili sauce
- 1 whole lime
Instructions
- 1
Preheat oven to 400°F and line a sheet pan with parchment paper.
- 2
Pat salmon dry and place skin-side down on the pan, then brush with sweet chili sauce.
- 3
Bake salmon for 12–14 minutes until flesh flakes easily with a fork.
- 4
Squeeze fresh lime juice over the baked salmon just before serving.
Tools you’ll need
- sheet pan
- parchment paper
- pastry brush
- oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
