Sweet Chili Baked Meatballs
Frozen meatballs tossed in sweet chili sauce and baked until sticky and caramelized, finished with a squeeze of fresh lime. Ready in 20 minutes—zero prep, maximum flavor.
- Total time
- 20 min
- Servings
- 4
- Calories
- 285
- Protein
- 16g
easysatisfyingamericanbeefstickytenderweeknightmain-dish
Ingredients
- 1 lb (about 20–24 pieces) frozen meatballs
- ¾ cup sweet chili sauce
- 1 whole lime
Instructions
- 1
Preheat the oven to 400°F and line a baking sheet with foil.
- 2
Spread frozen meatballs on the baking sheet in a single layer.
- 3
Drizzle sweet chili sauce over the meatballs and toss until evenly coated.
- 4
Bake for 15 minutes, stirring halfway through, until edges caramelize.
- 5
Squeeze lime juice over the top and serve hot.
Tools you’ll need
- oven
- baking sheet
- aluminum foil
- spoon or tongs
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
