Custrd is out on the App Store — Download it free →
Back to recipes

Sushi

Quick homemade sushi with seasoned rice, fresh fish, and veggies. Perfect for a fast weeknight dinner or snack.

Total time
25 min
Servings
4
Calories
350
Protein
20g
Sushi
quickfreshJapanesepescatarianfishchewytenderweeknight

Ingredients

  • 2 cups sushi rice
  • 3 tbsp rice vinegar
  • 1 tbsp sugar
  • 1 tsp salt
  • 8 oz sashimi-grade fish (like tuna or salmon)
  • 4 sheets nori sheets

Instructions

  1. 1

    Cook the 2 cups sushi rice according to package directions, then let it cool slightly until warm but not hot, about 10 minutes.

  2. 2

    In a small bowl, mix the 3 tbsp rice vinegar, 1 tbsp sugar, and 1 tsp salt until dissolved. Fold this into the warm rice, then let it cool to room temperature.

  3. 3

    Slice the 8 oz fish into thin strips about 1/2 inch wide. Cut each of the 4 nori sheets in half crosswise.

  4. 4

    Place a nori half on a bamboo mat or your palm. Spread a thin layer of rice over the nori, leaving a 1-inch strip at the top edge. Lay a few fish strips across the center.

  5. 5

    Roll tightly from the bottom, using the bare nori edge to seal. Slice each roll into 6 pieces and serve with soy sauce, wasabi, and pickled ginger if you have them.

Tools you’ll need

  • bamboo sushi mat (optional)
  • sharp knife
  • small bowl
  • pot with lid

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.