Custrd is out on the App Store — Download it free →
Back to recipes

Strawberry Daifuku Mochi

Soft, pillowy mochi filled with fresh strawberry and sweet red bean paste — a TikTok-viral Japanese dessert you can make at home in under 20 minutes with just a microwave and a few pantry staples.

Total time
18 min
Servings
4
Calories
185
Protein
1g
Strawberry Daifuku Mochi
lightrefreshingjapanesevegetariandairy-freechewysoftgooey

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix mochiko, sugar, and water in a microwave-safe bowl until smooth with no lumps.

  2. Step 2

    Microwave uncovered on high for 2 minutes. Stir well, then microwave 1 more minute until thick and glossy.

  3. Step 3

    Spread cornstarch on a plate. Pour hot mochi onto it and dust the top with more cornstarch. Let cool 5 minutes.

  4. Step 4

    Pat mochi lightly with cornstarch until it's no longer sticky. Divide into 8 pieces.

  5. Step 5

    Flatten each piece into a thin disc. Place 1 tsp bean paste and 1 strawberry in the center of each.

  6. Step 6

    Fold mochi edges up and around the filling, pinching and sealing at the top. Roll gently in palms to smooth.

  7. Step 7

    Serve immediately or refrigerate up to 2 days in an airtight container.

Tools you’ll need

  • microwave-safe bowl
  • microwave
  • spoon or spatula
  • dinner plate
  • parchment paper or airtight container

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.